Vaskuläre Kalzifizierung kommt bei den terminal niereninsuffizienten Patienten deutlich häufiger als bei der Normalbevölkerung vor. Einer der wichtigsten Risikofaktoren hierbei ist die Hypertonie. Studien zeigen, dass vaskuläre Kalzifizierung von inhibierenden Biomole-külen wie Pyrophosphat und den Fibroblast Growth Factor 23 (FGF-23) vermindert wird. Auch Senkung des Bluthochdruckes wirkt präventiv in Hinsicht auf die Entwicklung der vaskulären Kalzifizierung. Der Fokus dieser Arbeit lag auf der Isolierung und Identifizierung zweier neuer unbekannter Peptide: des Calcification Blockung Factor (CBF) und des Va-soconstriction Inhibiting Factor (VIF). Vorwiegend aus der Nebenniere sezerniert und als ein Bestandteil des humanen Plasmas, weisen beide vasoprotektive Eigenschaften im Ummodulierungsprozess der Gefäßwand, typisch für den durch erhöhte Phosphat und Kalziumlevel induzierten Kalzifizierungsprozess, auf. Diese Form der Kalzifizierung ist be-sonders häufig unter terminalen Niereninsuffizienten anzutreffen. Die Peptide wurden aus den bovinen Nebennieren isoliert und mittels unterschiedlicher chromatographischer Techniken bis zur Homogenität aufgereinigt. Nach dem Screening der Fraktionen durch den Kalzifizierungsbioassay, bzw. Nierenperfusionstest wurden die relevanten Fraktionen mittels unterschiedlicher massenspektrometrischer Techniken identi-fiziert. Mittels RapiDeNovo-Sequenzierung und nachfolgendem Mascot-Datenabgleich wurde der „Calcification Blockung Factor“ (CBF) mit der bovinen Sequenz: LE- GEEEEEEDPDRSMRLSF und der humanen Variante der Sequenz: LEG-QEEEEDNRDSSMKLSF identifiziert. Der „Vasokonstriktion Inhibiting Factor“ (VIF) wurde mittels Mascot Datenabgleich mit der bovinen Sequenz: HSSYEDELSEVLEKPNDQAEP- KEVTEEVSSKDAAE und der humanen Sequenz: HSGFEDELSEVLENQSSQAELKE-VEEPSSKDVME identifiziert. Des Weiteren wurde die Wirkung der Peptide CBF und VIF auf den Kalzifizierungsprozess mittels histologischer von Kossa Färbung des Gewebes qualitativ und mittels eines Kalzi-umkits quantitativ nachgewiesen. Der Kalziumgehalt des Gewebes in Anwesenheit der Peptide CBF und VIF war signifikant geringer als der Kalziumgehalt der Positivkontrollen. Die Wirkung des VIF Peptides auf die Gefäßkonstriktion wurde mittels des Nierenperfusi- onstests gezeigt. Die Vasokonstriktion des potenten Vasokonstriktors Angiotensin II wurde deutlich gemindert. Die massenspektrometrisch detektierte Plasmakonzentration des CBF Peptides bei den CKD Kranken hat sich signifikant niedriger erwiesen als bei den Nieren-gesunden: (0,14 ± 0,03 vs. 0,29 ± 0,04; in pM (n =10). Die massenspektrometrisch detek-tierte Plasmakonzentration des VIF Peptides bei den CKD Kranken hat sich tendenziell erhöht als bei den Nierengesunden erwiesen. Da CBF und VIF aus chrommafinen Granu-lazellen der Nebennieren sezerniert werden und in effektiven Konzentrationen im humanen Plasma nachweisbar sind, scheint die Regulationsfunktion der Peptide in der vaskulären Kalzifizierung, der Regulation des Vasotonus und damit in der Entwicklung der koronaren Herzkreislauferkrankungen sehr wahrscheinlich zu sein.
Vascular calcification occurs in terminal renal failure patients significantly more frequently than in the general population. One of the major risk factors here is the hypertension. Studies show that vascular calcification is reduced by biomolecules with inhibiting properties such as pyrophosphate and Fibroblast Growth Factor 23 (FGF-23). Also decreasing of high blood pressure has a preventive effect with respect to the development of vascular calcification. The focus of this work was the isolation and identification of two new unknown peptides: Calcification blocking factor (CBF) and the Vasoconstriction Inhibiting Factor (VIF). Predominantly secreted from the adrenal gland and as a component of human plasma, both peptides have vascular protective properties to vascular remodeling processes, typically induced by increased level of calcium and phosphate common in calcification process. This form of calcification is especially often found in terminal renal failure. The peptides were isolated from the bovine adrenal and purified by various chromatographic techniques to homogeneity. After the screening of the fractions by different bioassays the relevant fractions were analyzed and identified by different mass spectrometric techniques. By sequencing with RapiDeNovo and subsequent Mascot data matching the "Calcification blocking factor" (CBF) was identified with the bovine sequence: LEGEEEEEEDPDRSMRLSF and the human variant of the sequence: LEGQEEEEDNRDSSMKLSF. The "vasoconstriction inhibiting factor" (VIF) was determined by Mascot data synchronization with the bovine sequence: HSSYEDELSEVLEKPNDQAEP-KEVTEEVSSKDAAE and the human sequence: HSGFEDELSEVLENQSSQAELKE-VEEPSSKDVME. Furthermore, the effect of the peptides CBF and VIF on the calcification has been demonstrated by histological von Kossa Staining of the tissue qualitatively and qualitatively using a calcium-kit. The calcium content of the tissue in the presence of the peptides, VIF and CBF was significantly lower than the calcium content of the positive controls. The effect of the peptide VIF on the vasoconstriction was shown by a bioassay on isolated perfused rat kidney. The vasoconstriction of the potent vasoconstrictor angiotensin II was significantly reduced by the peptide. The plasma concentration of the mass spectrometrically detected CBF peptide in CKD patients was significantly lower than in kidney healthy subjects. Mass spectrometry detected plasma concentrations of VIF peptide in the CKD patients has tended to increase compared to in the kidney healthy subjects. Since CBF and VIF are secreted from chrommafine granula cells of the adrenal glands and can be detected in effective concentrations in human plasma, the regulation function of the peptides in vascular calcification, the regulation of vascular tonus and in the development of coronary artery vascular disease is very likely.
