Selektive, CRF-rezeptorsubtypspezifische Liganden sind für die Untersuchung der biologischen Aktivität der CRF/Urocortin Peptidfamilie mit ihren Rezeptorsubtypen von großer Notwendigkeit, da diese für viele biologische Prozesse bedeutsam und in einer Vielzahl von neuropsychiatrischen, neurodegenerativen sowie gastrointestinalen Störungen involviert sind. Das Ziel dieser Arbeit bestand darin, durch Struktur-Wirkungs-Untersuchungen den Einfluß bestimmter Aminosäureseitenketten innerhalb der Liganden der CRF/Urocortin Peptidfamilie und ihre Bedeutung für eine CRF- Rezeptorsubtypselektivität zu zeigen, um letztlich rezeptorsubtypselektive Agonisten zu entwickeln. Entsprechend der Zielsetzung gelang es, die cDNA beider CRF2-Rezeptor-Spleißvarianten aus Ratte (Rattus norvegicus) zu klonieren. Der rCRF1- und die beiden rCRF2-Rezeptoren wurden heterolog in HEK 293-Zellen transient und stabil exprimiert. Mit der Etablierung von Testsystemen, insbesondere stabil exprimierter CRF-Rezeptoren, wurde eine Grundlage für detaillierte Studien zur Signaltransduktion geschaffen. Transient und stabil exprimierte rCRF1-Rezeptoren lieferten unter Anwendung des 1-Seiten-Bindungsmodells identische Affinitäten in Sättigungsbindungsassays mit Sauvagin, obwohl unterschiedliche Rezeptorkapazitäten bestimmt worden waren. Das Bindungsverhalten ausgewählter Liganden der CRF/Urocortin Peptidfamilie an den heterolog exprimierten rCRF1- und rCRF2b-Rezeptoren korrelierte mit den relativen Bindungsaffinitäten, die an Rattenhirn- (rCRF1-Rezeptoren) und Mausherzmembranen (rCRF2b-Rezeptoren) vorlagen. Somit spiegeln die heterolog exprimierten rCRF-Rezeptorsysteme die nativen Systeme sehr gut wider. Die heterolog exprimierten rCRF-Rezeptoren wurden außerdem unter Verwendung von oCRF, Sauvagin, Urotensin I, r/hCRF, Urocortin I und Urocortin II im Adenylatcyclase Assay und in einem HTS- Bioassay, in dem die Agonist-induzierte Änderung von intracellulärem Calcium gemessen wird, pharmakologisch charakterisiert. Eine eindeutige Differenzierung zwischen Urocortin I und Urocortin II an beiden rCRF- Rezeptoren wurde in beiden funktionellen Assays erhalten, so daß die Basis für die Struktur-Wirkungs-Untersuchungen gewährleistet war. Im zweiten Teil der Arbeit wurde durch Struktur-Wirkungs-Untersuchungen gefunden, daß einzelne Aminosäureseitenketten innerhalb der Liganden der CRF/Urocortin Peptidfamilie einen unterschiedlichen Einfluß auf die CRF-Rezeptorsubtypselektivität haben: Der Austausch nicht konservierter Aminosäuren oder kurzer Peptidsequenzen (3 - 4 Aminosäuren) innerhalb der CRF/Urocortin Peptidfamilie zeigte, daß keine individuelle Aminosäure bzw. Peptiddomäne für die Selektivitätsunterschiede zwischen den untersuchten Liganden Sauvagin, Urotensin I und oCRF, sondern die Peptide in ihrer Gesamtsequenz für die Rezeptorselektivität verantwortlich sind. Auf der Grundlage des 2-Domänen-Bindungsmodells für Liganden dieser Peptidfamilie wurden N- und C-terminale Rezeptorbindungsdomänen des -helikalen Modellpeptids UEK(1-40) (DDPPLSIDLTFHLLRTLLEIEKEEKEKKRKEQNRKLLDEV- NH2) über helikale Linker variabler Länge verbunden und erbrachten hoch potente Agonisten, ohne eine Rezeptorsubtypselektivität zu zeigen. Die Verbindung von N- und C-terminaler Peptiddomäne durch einen hoch flexiblen -Amino-capronsäurerest als Linker führte dagegen zu Agonisten mit geringer Potenz unabhängig von ihrer Linkerlänge, die keine rCRF1-/rCRF2-Rezeptorselektivität zeigten. Angeregt durch die Entdeckung des CRF2-rezeptorselektiven Urocortin II wurde das Sequenzmotiv VPIG aus dem N-Terminus des Urocortin II in die korrespondierenden Positionen des nicht selektiven Urocortin I eingefügt. Aus dem nicht selektiven Urocortin I wurde ein selektiver Agonist am rCRF2-Rezeptor im HTS-Bioassay, der am rCRF1-Rezeptor keine agonistische Aktivität mehr zeigte. Das resultierende Peptid VPIG(9-12)-Urocortin I agierte mit 15 nM hoch potent am rCRF2b- Rezeptor. Die sich daraus ergebende Fragestellung, ob einzelne Aminosäuren dieser Tetrapeptidsequenz die Selektivität sowohl von VPIG(9-12)-Urocortin I als auch von Urocortin II bestimmen, führte zum Aufbau und zur Charakterisierung von zwei Peptidbibliotheken. Beide Bibliotheken mit jeweils 80 Liganden wurden durch Spot-Synthese an Cellulosemembranen synthetisiert. Die vier Aminosäuren innerhalb dieser Tetrapeptidsequenz im N-Terminus von Urocortin I und Urocortin II wurden jeweils durch eine andere der 20 proteinogenen Aminosäuren substituiert. Alle Liganden wurden im funktionellen HTS-Bioassay an allen drei CRF-Rezeptoren getestet. Ausgewählte Peptide wurden individuell durch SPPS hergestellt und ihre biologischen Aktivitäten in Adenylatcyclase Assays sowie in Bindungsstudien verifiziert. Die Substitutionsanalyse jeder Position im VPIG-Motiv des VPIG(9-12)-Urocortin I ergab, daß nur 5 von 80 Peptidanaloga eine hohe Aktivität bei 10 nM Peptid im HTS-Bioassay zeigten. Diese fünf Analoga waren selektiv am rCRF2-Rezeptor wirksam. Das resultierende Motiv für eine CRF2-Rezeptorselektivität für Urocortin I ist demnach VPXX in den Positionen 9 - 12, wobei P essentiell und mindestens ein X eine hydrophobe Aminosäureseitenkette ist. Dagegen zeigte die korrespondierende Substitutionsanalyse des VPIG-Motivs im N-Terminus von Urocortin II überraschend, daß 57 von 80 Analoga dieser Peptidbibliothek im HTS-Bioassay selektiv am rCRF2-Rezeptor waren und bei einer Peptidkonzentration von 10 nM eine hohe Aktivität hatten. Keine der individuellen Aminosäureseitenketten innerhalb dieses Motivs war essentiell für die hohe Rezeptorselektivität und -aktivität des Urocortin II am rCRF2-Rezeptor. Damit liegt die Selektivität des Urocortin II nicht im VPIG- Motiv begründet, und die CRF2-Rezeptorselektivität scheint prinzipiell durch andere Domänen im Urocortin II bestimmt zu sein. Somit konnte anhand dieser peptidischen Ligandbibliotheken demonstriert werden, daß die N-terminale Tetrapeptidsequenz in Urocortin I, aber nicht im Falle des Urocortin II, für die Ligand-Rezeptorsubtypselektivität verantwortlich ist. Hingegen führte der Einbau des VPIG-Motivs in andere Vertreter der CRF/Urocortin Peptidfamilie zu einem verschiedenartigen Einfluß auf die biologische Potenz und Rezeptorselektivität. Während im HTS-Bioassay VPIG(9-12)-Sauvagin, VPIG(10-13)-Urotensin I und VPIG(10-13)-r/hCRF am rCRF1-Rezeptor nur noch eine sehr geringe Potenz zeigten, erwies sich VPIG(9-12)-Sauvagin am rCRF2-Rezeptor als Agonist mit hoher Potenz (EC50 0,3 nM) und daher hoher rCRF2-Rezeptorselektivität. Dagegen wurde mit VPIG(10-13)-Urotensin I sowie VPIG(10-13)-r/hCRF eine geringe Potenz am rCRF2-Rezeptor und damit eine schwächere rCRF2-Rezeptorselektivität erhalten. Diese Ergebnisse zeigen, daß das VPIG-Motiv kein prinzipielles Selektivitätsmotiv für diese Ligandfamilie darstellt. Deshalb ist darüber hinaus zu erwarten, daß die Selektivität auch von anderen Domänen innerhalb dieser Peptidfamilie bestimmt wird. Insgesamt konnte gezeigt werden, daß durch Kombination aus leistungsfähiger Simultansynthese von Peptiden über Spot-Technologie und Durchführung eines zellulären HTS-Bioassays eine große Anzahl von Peptidliganden untersucht werden kann. Die Spot-Synthese gelingt selbst für Peptide mit einer Länge von 40 Aminosäuren und liefert quantitativ ausreichende Mengen an Analoga, deren im HTS-Bioassay ermittelten biologischen Aktivitäten im Adenylatcyclase Assay bestätigt werden konnten. Desweiteren erwies sich der HTS-Bioassay als hervorragend geeignet, um rationell und effizient das Screening einer großen Anzahl von Verbindungen zeitgleich an allen drei CRF-Rezeptoren zu gewährleisten. Mit VPIG(9-12)-Urocortin I und VPIG(9-12)-Sauvagin wurden zwei hoch potente und CRF2-rezeptorselektive Liganden entwickelt. Gleichzeitig weisen die Ergebnisse der Struktur-Wirkungs-Beziehungen nicht nur auf unterschiedliche Rezeptorbindungsdomänen der beiden Agonisten Urocortin I und Urocortin II am CRF2-Rezeptor hin, sondern machen auch deutlich, daß die verschiedenen Liganden der CRF/Urocortin Peptidfamilie offensichtlich unterschiedliche Bindungsmodi an den CRF-Rezeptoren haben.
Selective, CRF receptor subtype-specific ligands are necessary for the investigation of the biological activity of the CRF/urocortin peptide family and their receptor subtypes, because they are important for many biological processes. These receptors are involved in many neuropsychiatric, neurodegenerative and gastrointestinal disorders. The goal of this work was to show the influence of certain amino acid side chains of the ligands of the CRF/urocortin peptide family and to understand their meaning for a CRF receptor subtype selectivity. This was achieved by structure-activity relationship studies with the intention to develop receptor subtype-selective agonists. In the present study the cDNA of receptor splice variants CRF2a and CRF2b were cloned from rat (rattus norvegicus). The rCRF1 and both rCRF2 receptors were transiently and stably expressed in HEK 293 cells. With the establishment of test systems, in particular stably expressing CRF receptor cell lines, a basis was created for detailed studies of the receptor s signal transduction. Using one-site-fit transiently and stably expressed rCRF1 receptors showed identical affinities in the saturation binding assays with sauvagine, although different receptor capacities were determined. The binding behaviour of selected ligands of the CRF/urocortin peptide family on heterologously expressed rCRF1 and rCRF2b receptors correlated with the relative binding affinities, which were determined in rat brain (CRF1 receptors) and mouse heart (CRF2b receptors) membranes. Thus the heterologously expressed rCRF receptor systems reflect the native systems very well. In addition the heterologously expressed rCRF receptors were characterised by adenylatcyclase assay and a HTS biological assay, which measures the agonist-induced intracellular calcium change, using oCRF, sauvagine, urotensin I, r/hCRF, urocortin I and urocortin II. Both functional assays showed a clear differentiation between urocortin I and urocortin II on both rCRF receptor subtypes, so the basis of this work for structure-activity relationship studies of these ligands was given. The substitution of non- conserved amino acids or short peptide sequences (3 - 4 amino acids) within the CRF/urocortin peptide family showed that no individual amino acid or peptide domain is responsible for the differences in receptor selectivity found among the examined ligands sauvagine, urotensin I and oCRF. Instead, it seems that the overall sequence of the peptides is responsible for receptor selectivity. Based on the model of two segregated receptor binding domains of CRF receptor ligands, N- and C-terminal receptor binding sites of an -helical model peptide UEK(1-40) (DDPPLSIDLTFHLLRTLLEIEKEEKEKKRKEQNRKLLDEV-NH2) were connected by helical linkers of variable lengths and yielded highly potent agonists without any receptor subtype selectivity in the HTS biological assay. Connection of the two binding sites by highly flexible -aminocaproic acid residue linkers resulted in agonists with weak potencies independent of the linker length. They did not affect the receptor subtype selectivity on rCRF1 or rCRF2 receptor. After the discovery of the CRF2 receptor-selective urocortin II, the sequence motif VPIG within the N-terminus of urocortin II was inserted into the corresponding positions of the non-selective urocortin I. This resulted in a selective agonist on the rCRF2 receptor in the HTS biological assay. No agonistic activity could be detected on the rCRF1 receptor. The resulting peptide VPIG(9-12)-urocortin I was highly potent (EC50 15 nM) on the rCRF2b receptor. The question arising from this finding, whether individual amino acids of this tetrapeptide sequence determine the selectivity of both VPIG(9-12)-urocortin I and urocortin II itself, led to the setup and characterisation of two peptide libraries. Both libraries, each with 80 ligands, were synthesised by spot-synthesis on cellulose membranes. The four amino acid residues of the tetrapeptide sequence of the N-terminal region of urocortin I and urocortin II were substituted by each of the 20 proteinogenic amino acids (positional scanning). All ligands were tested in the functional HTS biological assay on all three CRF receptors. Selected peptides were individually synthesised by SPPS and their biological activities were verified by adenylatcyclase assays and binding studies. The substitution analysis of each position in the VPIG motif of the VPIG(9-12)-Urocortin I resulted in only 5 of 80 peptide analogues showing a high activity at concentrations of 10 nM in the HTS Bioassay. These analogues were selective for the rCRF2 receptors. The essential motif for this selective CRF2 activity of urocortin I was found to be VPXX at positions 9 - 12, whereby P is essential and at least one X is a residue with hydrophobic side chain. On the other hand, the corresponding substitution analysis of the VPIG motif in the N-terminal region of urocortin II surprisingly showed that 57 of 80 analogues of this peptide library were selective for the rCRF2 receptor and had a high activity at concentrations of 10 nM in the same assay. None of the individual amino acid side chains within this motif were essential for the high receptor selectivity and activity of urocortin II on the rCRF2 receptor. Thus the selectivity of urocortin II does not result from the VPIG motif itself and in principle the CRF2 receptor selectivity seems to be determined by other domains in urocortin II. With the help of these peptide libraries, it could be demonstrated that the N-terminal tetrapeptide sequence motif in urocortin I, but not in the case of urocortin II, is responsible for the ligand-receptor subtype selectivity. However, the incorporation of the VPIG motif into other members of the CRF/urocortin peptide family led to a change of their biological potencies and receptor selectivities. Whereas VPIG(9-12)-sauvagine, VPIG(10-13)-urotensin I and VPIG(10-13)-r/hCRF only showed very little potency on the rCRF1 receptor in the HTS biological assay, VPIG(9-12)-sauvagine proved to be an agonist with high potency (EC50 0.3 nM) for the rCRF2 receptor and, therefore, high rCRF2 receptor selectivity. On the other hand, VPIG(10-13)-urotensin I as well as VPIG(10-13)-r/hCRF showed little potency on the rCRF2 receptor and thus a weaker rCRF2 receptor selectivity was observed. These results show that the VPIG motif does not represent a motif for selectivity in principle for this ligand family. Therefore, it is expected that the selectivity within this peptide family is also determined by other domains. Conclusively, it could be shown that a large number of peptides can be examined by combination of efficient simultaneous synthesis of peptides using the spot-technology and employment of a cellular HTS biological assay. The spot-synthesis succeeds even for peptides with a length of 40 amino acids and supplies sufficient quantities of analogues, whose biological activities determined by the HTS Bioassay, could be confirmed by adenylatcyclase assay. Furthermore the HTS Bioassay proved outstandingly suitable for ensuring rationally and efficiently the screening of a large number of compounds in parallel at all three CRF receptors. With VPIG(9-12)-urocortin I and VPIG(9-12)-sauvagine two highly potent and CRF2 receptor-selective ligands were developed. The results of the structure-activity relationship studies refer not only to different receptor binding sites of the two agonists urocortin I and urocortin II on the CRF2 receptor, but also make clear that the different ligands of the CRF/urocortin peptide family obviously have different binding modes on the CRF receptors.
